PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA8651
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 346aa    MW: 39671.4 Da    PI: 6.3324
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA8651genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.93.1e-26218267352
                    RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                               ++i+l dl kyF++pi +A+k+L+v+lTvLK++CR++GI+RWPhRkiksl
  Tp57577_TGAC_v2_mRNA8651 218 AKITLPDLVKYFDMPIVEASKSLNVGLTVLKKKCREFGIPRWPHRKIKSL 267
                               589*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.531202287IPR003035RWP-RK domain
PfamPF020427.5E-22220267IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MDSSLTTLLL FNNTIQPELM RSVHVYRGEC DGEEREVERE VEREFVFSKN GSYVEMQATP  60
ILSLLKSFVS KEIFEGYTNG VWLCIFAFHA YNTPPFSHIP TLLLVTRNPK LQAIPNLLND  120
LHMIYKLVPK EEPKDTPESS TAEESKGNNN NFQPPKKLFP VLNQDLNCLP YEDDESELLD  180
DKSGLLDNKS ELLGDETDFE SSSGSVGKKK RAASDIVAKI TLPDLVKYFD MPIVEASKSL  240
NVGLTVLKKK CREFGIPRWP HRKIKSLDSL IHDLQEEAKH QDMEDKAAAM AVLRRQKMLE  300
CEKENIEKMP FMDIRSETKR FRQEVFKRRH RSRVMEKQNS TVASN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4755684e-70CU475568.2 Medicago truncatula chromosome 5 clone mth2-61f16, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003612350.10.0plant regulator RWP-RK family protein
TrEMBLG7K0410.0G7K041_MEDTR; Plant regulator RWP-RK family protein
STRINGGLYMA01G36360.11e-165(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96463042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.17e-83RWP-RK domain-containing protein